PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna28435.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 208aa    MW: 23208 Da    PI: 8.0755
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna28435.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171764148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
  mrna28435.1-v1.0-hybrid 17 KGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYL 64
                             79********************************************97 PP

2Myb_DNA-binding55.61.2e-1770113146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++
  mrna28435.1-v1.0-hybrid  70 RGNITPEEQLLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 113
                              7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-241067IPR009057Homeodomain-like
PROSITE profilePS5129415.9171264IPR017930Myb domain
SuperFamilySSF466891.5E-3015111IPR009057Homeodomain-like
SMARTSM007178.1E-131666IPR001005SANT/Myb domain
PfamPF002491.5E-161764IPR001005SANT/Myb domain
CDDcd001675.34E-111964No hitNo description
PROSITE profilePS5129425.85965119IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-2568119IPR009057Homeodomain-like
SMARTSM007171.8E-1569117IPR001005SANT/Myb domain
PfamPF002491.6E-1670113IPR001005SANT/Myb domain
CDDcd001674.74E-1374113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MDKKPCNSSS QDAEVRKGPW TMEEDLILIN YIANHGEGVW NSLAKSAGLK RTGKSCRLRW  60
LNYLRPDVRR GNITPEEQLL IMELHAKWGN RWSKIAKHLP GRTDNEIKNY WRTRIQKHIK  120
QGDQSNSQGQ SSDGTADQAS TSKVGSSSTV GLDAMETTYP LCAPTASYPA TLVQPPAHPN  180
VLPPGDSNQD NYWSMEDLWS MQLLNGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-261411924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0992300.0KM099230.1 Fragaria x ananassa subsp. ananassa emission of benzenoids II protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011468270.11e-154PREDICTED: myb-related protein 305-like
SwissprotP813918e-97MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A0K0MAN21e-149A0A0K0MAN2_FRAAN; Emission of benzenoids II protein
STRINGVIT_14s0066g01090.t016e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.12e-84myb domain protein 21